PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang03g16900.1
Common NameLR48_Vigan272s000200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family CO-like
Protein Properties Length: 410aa    MW: 44563.6 Da    PI: 4.536
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang03g16900.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.25.3e-06444539
        zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                    +C+ +++++   +C+++  +lC +C  + H+       H++
  Vang03g16900.1  4 ICDFCGDQRSMVYCRSDAACLCLSCDRNVHSAnalsrrHSR 44
                    7*****************************65677777766 PP

2zf-B_box20.31.2e-064686439
        zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                      C++++++++   C + +  lC++C   +H g      H++
  Vang03g16900.1 46 LLCERCNSQPAFVRCVEEKISLCQNCDWLGH-GvstsstHKR 86
                    57*************************9999.6677777775 PP

3CCT60.45.9e-21352395144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     R +a+lRYkeK+k RkFeK++rY+sRKa+A+ R RvKGrFvk+ 
  Vang03g16900.1 352 RSNAVLRYKEKKKARKFEKQVRYASRKARADIRRRVKGRFVKAG 395
                     899**************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.684147IPR000315B-box-type zinc finger
CDDcd000219.51E-7447No hitNo description
SMARTSM003363.1E-8447IPR000315B-box-type zinc finger
PROSITE profilePS501198.7314389IPR000315B-box-type zinc finger
CDDcd000213.12E-44787No hitNo description
SMARTSM0033624889IPR000315B-box-type zinc finger
PROSITE profilePS5101715.051352394IPR010402CCT domain
PfamPF062032.5E-15352394IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MGYICDFCGD QRSMVYCRSD AACLCLSCDR NVHSANALSR RHSRTLLCER CNSQPAFVRC  60
VEEKISLCQN CDWLGHGVST SSTHKRQGIS CYSGCPSAAE LSSIWSFVLD IPSIRESTCE  120
QELGLMSINE NSESVGVPPE NGNVSVSDQV TDLPALDRSF VGTSSIPESS SETRILDQPD  180
GPANECLPKL YCPATKCPAL CEDDNLYDDF DMDEVDLNLE NYEELFGMAL SHSEELFENG  240
GIDSLFGTKD MSAGDSSCQD AIAAEGSSVG LVNATQPACS NAASADSILS TKTEPILCFT  300
GRQAQSNLSF SGITGESSAA DYQDCGTTSM LLMGEPPWFA PCPENSLQSA NRSNAVLRYK  360
EKKKARKFEK QVRYASRKAR ADIRRRVKGR FVKAGDVYDY DPLSTTRSC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150380.0AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014523701.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9
RefseqXP_014523702.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9
RefseqXP_014523703.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9
RefseqXP_014523704.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9
RefseqXP_014523705.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9
RefseqXP_014523707.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9
RefseqXP_014523708.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9
RefseqXP_014523709.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9
SwissprotQ9SSE51e-154COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
TrEMBLA0A0L9T8J60.0A0A0L9T8J6_PHAAN; Uncharacterized protein
TrEMBLA0A0S3S8470.0A0A0S3S847_PHAAN; Uncharacterized protein
STRINGGLYMA13G11592.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07650.41e-145CONSTANS-like 9
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]